ELISA Recombinant Vicia faba Legumin type B(LEB6),partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171018 Research areas: Others Target / Protein: LEB6 Biologically active: Not Tested Expression system: Yeast Species of origin: Vicia faba (Broad bean) (Faba vµLgaris) Delivery time: 3-7 business days Uniprot ID: P16079 AA Sequence: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN Tag info: N-terminal 6xHis-tagged Expression Region: 1-148aa Protein length: Partial MW: 19.0 kDa Alternative Name(s): Legumin type B acidic chain Relevance: This protein found in the seeds of many leguminous and non-leguminous plants is the source of sµLfur-containing amino acids in seed meals. Reference: "The legumin gene family: structure and evolutionary implications of Vicia faba B-type genes and pseudogenes." Heim U., Schubert R., BaeumLein H., Wobus U. Plant Mol. Biol. 13:653-663(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.