ELISA Recombinant Vicia faba Legumin type B(LEB6),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P16079 Gene Names: LEB6 Organism: Vicia faba (Broad bean) (Faba vµLgaris) AA Sequence: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN Expression Region: 1-148aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 19 kDa Alternative Name(s): Legumin type B acidic chain Relevance: This protein found in the seeds of many leguminous and non-leguminous plants is the source of sµLfur-containing amino acids in seed meals. Reference: "The legumin gene family: structure and evolutionary implications of Vicia faba B-type genes and pseudogenes." Heim U., Schubert R., BaeumLein H., Wobus U. Plant Mol. Biol. 13:653-663(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.