ELISA Recombinant Rat Regenerating islet-derived protein 3-beta(Reg3b)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P25031 Gene Names: Reg3b Organism: Rattus norvegicus (Rat) AA Sequence: EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG Expression Region: 27-175aa Sequence Info: FµLl Length of Mature Protein Source: Yeast Tag Info: N-terminal 6xHis-sumostar-tagged MW: 32.6 kDa Alternative Name(s): Pancreatitis-associated protein 1;Peptide 23REG-2Regenerating islet-derived protein III-beta ;Reg III-beta Relevance: Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues Reference: Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis.Iovanna J., Orelle B., Keim V., Dagorn J.-C.J. Biol. Chem. 266:24664-24669(1991) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.