Skip to Content

ELISA Recombinant Staphylococcus aureus Gamma-hemolysin component B(hlgB)

https://www.anagnostics.com/web/image/product.template/158606/image_1920?unique=263afdf
(0 review)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: others Target / Protein: hlgB Biologically active: Not Tested Expression system: Yeast Species of origin: Staphylococcus aureus (strain N315) Delivery time: 3-7 business days Uniprot ID: P0A075 AA Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK Tag info: N-terminal 6xHis-tagged Expression Region: 26-325aa Protein length: FµLl Length of Mature Protein MW: 36.1 kDa Alternative Name(s): H-gamma-1 H-gamma-I Relevance: Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity Reference: "Shotgun proteomic analysis of total and membrane protein extracts of S. aureus strain N315." Vaezzadeh A.R., Deshusses J., Lescuyer P., Hochstrasser D.F. Submitted (OCT-2007) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,170.00 € 1170.0 EUR 1,170.00 €

1,170.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.