ELISA Recombinant Staphylococcus aureus Enterotoxin type H(entH)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P0A0M0 Gene Names: entH Organism: Staphylococcus aureus AA Sequence: EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV Expression Region: 25-241aa Sequence Info: FµLl Length of Mature Protein Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 27.1 kDa Alternative Name(s): SEH Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Reference: "The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecµLes."Haekansson M., Petersson K., Nilsson H., Forsberg G., Bjoerk P., Antonsson P., Svensson L.A.J. Mol. Biol. 302:527-537(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.