ELISA Recombinant Saccharomyces cerevisiae Saccharopepsin(PEP4)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Cell Biology Uniprot ID:P07267 Gene Names:PEP4 Organism:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) AA Sequence:GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI Expression Region:77-405aa Sequence Info:FµLl Length of Mature Protein Source:Yeast Tag Info:N-terminal 10xHis-tagged MW:38.2 Alternative Name(s):Aspartate protease (PrA) (Proteinase A) (Carboxypeptidase Y-deficient protein 4) (Proteinase YSCA) (PHO9) (PRA1) Relevance:Aspartyl protease implicated in the post-translational regµLation of S.cerevisiae vacuolar proteinases. Acts on YSCB, on YSCY and on itself. Reference:"The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regµLators." Purnelle B., Coster F., Goffeau A. Yeast 12:1483-1492(1996) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:25-35 business days