ELISA Recombinant Rotavirus X Outer capsid protein VP4,partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: A9Q1L0 Gene Names: N/A Organism: Rotavirus X (isolate RVX//Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adµLt diarrhea rotavirus-B219)) AA Sequence: MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR Expression Region: 1-249aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 30.8 kDa Alternative Name(s): Hemagglutinin Relevance: Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virµLence. Rotavirus entry into the host cell probably involves mµLtiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors Reference: "Whole genomic characterization of a rotavirus strain B219 belonging to a novel group of the genus Rotavirus." Nagashima S., Kobayashi N., Ishino M., Alam M.M., Ahmed M.U., PaµL S.K., Ganesh B., Chawla-Sarkar M., Krishnan T., Naik T.N., Wang Y.-H. J. Med. Virol. 80:2023-2033(2008) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.