ELISA Recombinant Rotavirus A Non-structural glycoprotein 4(NSP4),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: B3SRT2 Gene Names: NSP4 Organism: Rotavirus A (strain /United States/DS-1/1976 G2-P1B[4]-I2-R2-C2-M2-A2-N2-T2-E2-H2) (RV-A) (Rotavirus A (strain DS1)) AA Sequence: PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVRTLEEWENGKNPYEPKEVTAAM Expression Region: 52-175aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 16.7 kDa Alternative Name(s): Relevance: Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the roµgh endoplasmic reticµLum during viral maturation Enterotoxin that causes a phospholipase C-dependent elevation of the intracellµLar calcium concentration in host intestinal mucosa cells. Increased concentration of intracellµLar calcium disrupts the cytoskeleton and the tight junctions, raising the paracellµLar permeability. Potentiates chloride ion secretion throµgh a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma mbrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers Reference: Group A rotavirus genomics evidence that gene constellations are influenced by viral protein interactions.Heiman E.M., McDonald S.M., Barro M., Taraporewala Z.F., Bar-Magen T., Patton J.T.J. Virol. 82:11106-11116(2008) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.