ELISA Recombinant Rat Prolactin-inducible protein homolog(Pip)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: O70417 Gene Names: Pip Organism: Rattus norvegicus (Rat) AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN Expression Region: 27-146aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 15.7 kDa Alternative Name(s): Prolactin-induced protein Relevance: Reference: Expression of gross cystic disease fluid protein-15/Prolactin-inducible protein in rat salivary glands.Mirels L., Hand A.R., Branin H.J.J. Histochem. Cytochem. 46:1061-1071(1998) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.