ELISA Recombinant Platanus acerifolia Putative invertase inhibitor

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Allergen Uniprot ID: Q8GT41 Gene Names: N/A Organism: London plane tree AA Sequence: ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA Expression Region: 24-179aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 18.6 kDa Alternative Name(s): Pollen allergen Pla a 1 Allergen: Pla a 1 Relevance: Invertase inhibitor. Reference: "The major Platanus acerifolia pollen allergen Pla a 1 has sequence homology to invertase inhibitors."Asturias J.A., Ibarrola I., Eraso E., Arilla M.C., Martinez A.Clin. Exp. Allergy 33:978-985(2003) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.