ELISA Recombinant Rat Podocalyxin(Podxl),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: Q9WTQ2
Gene Names: Podxl
Organism: Rattus norvegicus (Rat)
AA Sequence: QDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSVQPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSSDKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSASVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTEEFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKPHEELLILNLTRDSFCKGSPPNERFLELLCHSAKASFKPAEDSCALELAPILDNQAVAVKRIVIETKLSPKAVFELLKDKWDDLTEAGVIDIHLGKEGPPEVNEDRFS
Expression Region: 25-386aa
Sequence Info: ExtracellµLar Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 39.8 kDa
Alternative Name(s): Podocalyxin-like protein 1 ;PC ;PCLP-1
Relevance: Involved in the regµLation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecµLe that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repµLsion. Acts as a pro-adhesive molecµLe, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma mbrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubµLogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion throµgh its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
Reference: Rat podocalyxin.Kobayashi T.Expression of podocalyxin inhibits cell-cell adhesion and modifies junctional properties in Madin-Darby canine kidney cells.Takeda T., Go W.Y., Orlando R.A., Farquhar M.G.Mol. Biol. Cell 11:3219-3232(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.